PNC-27 Research: A p53-Derived Chimeric Peptide and the Limits of Its Evidence
PNC-27 is a compound about which a great deal is claimed online and about which, in humans, nothing at all is known. This page exists to draw that line clearly. It describes the peptide’s chemistry, the hypothesis proposed to explain its behaviour in cell culture, what the published experiments actually measured and in which systems, who performed them and what interests they disclosed — and it states plainly that there is no human clinical evidence of any kind and no registered clinical trial. Nothing on this page is a claim of benefit, treatment or outcome, and nothing on it should be read as one.
What is PNC-27?
What is PNC-27? A synthetic 32-residue chimeric peptide — two functional pieces joined into one chain. The first fifteen residues correspond to residues 12–26 of the human p53 protein, the segment involved in p53’s binding to HDM-2 (the human homologue of MDM2, an E3 ubiquitin ligase that regulates p53). The remaining seventeen residues are a cell-penetrating leader the originating authors call the membrane residency peptide, based on the penetratin sequence.
The full sequence is stated in the 2022 Biomedicines paper’s methods section, and is reproduced in the reference table below because the peptide’s identity is the one thing on this page that can be checked analytically.
Two pieces of naming hygiene are worth establishing before anything else. HDM-2 and MDM2 are the same protein — HDM-2 is the human-specific designation, and this literature uses it consistently. And PNC-27 is not p53: it is a fifteen-residue fragment of p53 attached to something p53 does not have, and its proposed behaviour is not p53’s behaviour. Claims that conflate the two are conflating a protein with a peptide that borrows part of its surface.
Discovery and origin in the literature
A structural question first
The programme starts with structure. Rosal and colleagues reported in Biochemistry in 2004 (PMID 14967026) a two-dimensional NMR study of the 32-residue PNC-27 sequence in two environments — an aqueous, cytosol-like solution and a mixed organic membrane-mimetic solution. In water they described three alpha-helical domains connected by loops, forming an S shape; in the membrane-mimetic environment the helices lengthened into a U-shaped helix–coil–helix ensemble. In both, the peptide adopted amphipathic structures, hydrophobic residues on one face and polar residues on the other.
That amphipathicity is the physical property the whole programme rests on: it is what allows a peptide to insert into and disrupt a lipid bilayer. It is also, it is worth noting, a property shared by a very large number of peptides, including the antimicrobial peptides described on our LL-37 and KPV pages. Membrane-disrupting amphipathic helices are common; selectivity between cell types is the hard part.
The selectivity hypothesis
Sarafraz-Yazdi and colleagues addressed selectivity in PNAS in 2010 (PMID 20080680), and the argument runs in four steps as the paper presents it. First, the previously determined structure of the p53 residues within PNC-27 was found to be superimposable on the structure of the same residues bound to HDM-2 — suggesting the peptide could target HDM-2. Second, the authors reported detecting HDM-2 in the membranes of a range of cancer cell lines but not in the membranes of several untransformed lines. Third, colocalisation experiments were reported to show PNC-27 binding membrane-bound HDM-2. Fourth — the step that carries the most weight — they transfected untransformed MCF-10-2A cells, which were not susceptible to the peptide, with a plasmid expressing full-length HDM-2 carrying a membrane-localisation signal, and reported that these cells became susceptible.
That fourth experiment is a real attempt at a causal test rather than a correlation, and it deserves credit as such. It is also a single experiment, in one cell line, from the group proposing the hypothesis.
Reference data
From the public chemical record (PubChem CID 16201774) and the sequence stated in the 2022 primary paper.
| Property | Value |
|---|---|
| Peptide class | Synthetic chimeric peptide, 32 residues |
| Sequence | PPLSQETFSDLWKLL-KKWKMRRNQFWVKVQRG |
| Residues 1–15 | p53 residues 12–26 (HDM-2 binding domain) |
| Residues 16–32 | Membrane residency peptide (penetratin-derived leader) |
| Molecular formula | C₁₈₈H₂₉₃N₅₃O₄₄S |
| Molecular weight | ≈ 4032 g/mol |
| CAS number | 1159861-00-3 |
| PubChem CID | 16201774 |
| Related peptides | PNC-28 (different p53 segment); PNC-29 (negative control used throughout this literature) |
| Registered clinical trials | None — ClinicalTrials.gov returns zero studies |
| Physical form | Lyophilized powder |
| Storage | Kept cold and dry as supplied; protected from light |
The single sulfur atom in that formula is the methionine at position 20 of the leader sequence. No reconstitution procedure, quantity or route is given or implied on this page.
Mechanisms researchers have examined
- Binding to membrane-localised HDM-2. The central proposed mechanism, set out in the PNAS 2010 paper. It rests on the reported presence of HDM-2 in transformed-cell membranes and its reported absence from untransformed-cell membranes.
- Pore formation. The 2022 Biomedicines paper (PMID 35625682) approached this with immuno-scanning electron microscopy, labelling PNC-27 with 6 nm gold particles and HDM-2 with 15 nm particles. The authors reported the two labels in roughly 1:1 ratios arranged in layered ring-shaped structures at pores near the cell surface, and reported no pores in PNC-27-treated untransformed fibroblast controls. From this and conformational energy calculations they proposed that the pores are lined by PNC-27–HDM-2 complexes.
- Necrosis rather than apoptosis. Across this literature the reported mode of cell death is membranolytic necrosis, not programmed cell death. Bowne et al. (2008, Ann Surg Oncol, PMID 18931881) reported this for the related PNC-28 peptide in human pancreatic cancer cell lines and attributed it to the penetratin sequence.
- Activity as the intact peptide. Sookraj et al. (2010, Cancer Chemother Pharmacol, PMID 20182728) addressed whether the effect required the whole chain or a breakdown fragment, reporting that lysis was induced by the intact peptide.
- A different downstream account. Wang et al. (2020, Leukemia, PMID 31337857) proposed a mechanism that is related but not identical: that PNC-27 binding to membrane HDM-2 enhances its interaction with E-cadherin, leading to E-cadherin ubiquitination and degradation and thence to membrane damage. That two groups propose different downstream chains from the same binding event is a sign the mechanism is not settled.
What the published studies measured, and in what
The distinction that matters most on this page is between what was measured and what it is evidence for. Every item below is the former.
Cell-culture work
The bulk of the literature is cell lines. Davitt et al. (2014, Ann Clin Lab Sci, PMID 25117093) examined a poorly differentiated human leukaemia line and reported that the observed necrosis depended on plasma-membrane HDM-2 expression. Later papers from the same lineage extended the panel to ovarian, colon and cervical lines, and to patient-derived material ex vivo. These are dish experiments. Selective cytotoxicity in a dish is a routine and necessary first observation for any candidate compound, and it is the observation most frequently mistaken for something larger.
The animal work, and the one independent group
Wang and colleagues (2020) published in Leukemia from City of Hope Medical Center and Zhejiang University — a different research lineage from the SUNY Downstate programme, and the strongest external engagement this compound has received. They reported that membrane HDM-2 was detectable on human and mouse acute myeloid leukaemia blasts including leukaemia-stem-cell-enriched subpopulations but not on normal haematopoietic stem cells; that PNC-27 administration reduced blast and stem-cell populations in primary and secondary transplant experiments in human and murine AML models; and that normal haematopoietic stem-cell activity was spared in wild-type transplant experiments.
That is a substantial animal dataset in a strong journal from an unaffiliated group, and this page reports it as such. The paper’s own conflict-of-interest statement records that Oncolyze Inc supplied PNC-27 and the control peptides for the study — commercial involvement in materials, disclosed, which is normal practice and is noted here for completeness rather than as a criticism.
Research models and evidence status
Who has produced this work
With the exception above, the literature is one programme. Pincus, Michl, Sarafraz-Yazdi, Bowne, Adler and colleagues, based at SUNY Downstate Medical Center with collaborators at Drexel and Thomas Jefferson, appear across essentially every primary paper and every review from 2004 to 2024. A substantial portion of it is published in a small number of journals, notably Annals of Clinical and Laboratory Science. The 2022 Biomedicines paper carries an explicit conflict-of-interest statement recording that three authors are inventors on intellectual property and patents relating to PNC-27 and PNC-28. Two commercial entities appear in the record: NomoCan Pharmaceuticals as an author affiliation, and Oncolyze Inc as a materials supplier.
None of that makes the findings wrong. Inventors publishing on their own inventions is how translational research works, and the disclosures are exactly what disclosure is for. It does mean that the independent-replication test — the thing that actually validates a result — has been run once, by Wang and colleagues, on the animal question, and not at all on most of the rest.
What is not established
This section is the most important on the page.
- There is no human clinical evidence. None. A ClinicalTrials.gov search for PNC-27 returns zero registered studies of any phase in any country. There is no published trial, no case series, no human pharmacokinetic data, no human safety or tolerability data, and no regulatory approval anywhere. Twenty years after the first structural paper, the compound has not entered clinical development.
- The central premise is not independently established. The claim that HDM-2 is present in the plasma membrane of cancer cells and absent from that of normal cells is the load-bearing assumption of the entire mechanism. It is reported by the originating group and by Wang et al. in AML specifically; it is not a broadly established fact of cell biology, and a reader should treat it as a hypothesis under test rather than as background.
- Selectivity in a dish is not selectivity in an organism. Cultured cell lines differ from tissue in membrane composition, in proliferation rate and in the absence of an immune system, stroma, circulation and clearance. The history of oncology is substantially a history of compounds that killed cancer cells selectively in culture and did not translate.
- The downstream mechanism is contested within the literature itself. Pore formation lined by peptide–HDM-2 complexes, and E-cadherin ubiquitination following enhanced HDM-2 interaction, are two different accounts of what happens after binding. Both are proposals.
- No dosing, exposure or administration information appears in this page and none should be inferred from it.
A note on what circulates about this compound
PNC-27 attracts claims online that go far beyond anything in the papers cited here — up to and including assertions that it cures cancer. It does not follow from anything published. The published record is: a structural characterisation, a hypothesis about membrane HDM-2, a body of cell-culture work from one programme, one substantial independent animal study in AML, and no human data whatsoever. Anyone encountering a stronger claim than that should ask which paper it comes from, in what system the result was obtained, and whether a human has ever received the compound in a registered study. The answer to the last question, at the time of writing, is no.
Nothing in this literature establishes any property of the supplied research material in a person. This page makes no efficacy, therapeutic, anti-cancer, anti-tumour or other use claim of any kind, and the material is supplied for laboratory research use only — not for human or veterinary use.
How to verify this compound yourself
The scientific uncertainty above has nothing to do with the analytical questions, and the analytical questions are answerable:
- Mass-spec identity against a known figure. PNC-27 has a catalogued formula and mass (≈4032 Da) and a CAS number, so a measured mass can be checked against a public record — a stronger position than most compounds in this library, several of which have no chemical registry entry at all.
- Distinguishing PNC-27 from its relatives is a mass question. PNC-28 and the PNC-29 control peptide share the same leader sequence and differ in the p53-derived portion. They are different masses and are resolved unambiguously by mass spectrometry; they are not resolved by a label.
- HPLC purity on a 32-mer is a meaningful number. At this length, solid-phase synthesis accumulates deletion sequences, and the purity figure carries real information. For reference, the 2022 paper reports its own synthesised material as >95% pure by HPLC and mass spectrometry — a useful benchmark for what a research-grade batch of this peptide should look like.
- Methionine oxidation is a storage variable. The single methionine in the leader sequence can oxidise to the sulfoxide, 16 Da heavier, particularly in solution and in light. A satellite peak 16 Da above the expected mass is the signature.
- Counter-ion documentation — a highly basic peptide with multiple arginines and lysines carries a substantial counter-ion load, usually trifluoroacetate, which affects net peptide content per unit mass. Documentation question, not a purity failure.
See how to read a COA for what each certificate line means, and how to verify peptide purity for how the methods fit together. The exact batch received can be checked on the self-serve verify tool.
Research-grade sourcing and verification
PNC-27 is not held in stock. It is listed on our sourcing catalogue as available to order — our supplier lists it, we have not bought it, and material of this kind typically takes about two to three weeks to reach us. For laboratory research use only, it is supplied with a per-batch Certificate of Analysis reporting HPLC purity (%) and mass-spec identity confirmation, verifiable at the lot level. For another peptide in this library designed to disrupt a specific protein–protein interaction and equally without human data, see FOXO4-DRI research; for a membrane-active peptide whose amphipathic mechanism is far better characterised, see LL-37 research. This is sourcing and quality-assurance framing only.
Verify a batch
Every order ships with a per-batch Certificate of Analysis. Have a vial in hand? Enter its lot number to look up the COA for that exact batch.
Frequently asked questions
What is PNC-27?
What is the proposed mechanism?
Has PNC-27 been tested in humans?
Is the research independent?
Why does this compound attract exaggerated claims online?
What is PNC-28, and how does it differ?
Literature cited
- Rosal R, Pincus MR, Brandt-Rauf PW, Fine RL, Michl J, Wang H. “NMR solution structure of a peptide from the mdm-2 binding domain of the p53 protein that is selectively cytotoxic to cancer cells.” Biochemistry. 2004;43(7):1854–1861. PMID 14967026. pubmed.ncbi.nlm.nih.gov/14967026. The structural characterisation.
- Bowne WB, Sookraj KA, Vishnevetsky M, et al. “The penetratin sequence in the anticancer PNC-28 peptide causes tumor cell necrosis rather than apoptosis of human pancreatic cancer cells.” Ann Surg Oncol. 2008;15(12):3588–3600. PMID 18931881. pubmed.ncbi.nlm.nih.gov/18931881.
- Sarafraz-Yazdi E, Bowne WB, Adler V, et al. “Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes.” Proc Natl Acad Sci U S A. 2010;107(5):1918–1923. PMID 20080680. pubmed.ncbi.nlm.nih.gov/20080680. The membrane-HDM-2 hypothesis.
- Sookraj KA, Bowne WB, Adler V, Sarafraz-Yazdi E, Michl J, Pincus MR. “The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide.” Cancer Chemother Pharmacol. 2010;66(2):325–331. PMID 20182728. pubmed.ncbi.nlm.nih.gov/20182728.
- Davitt K, Babcock BD, Fenelus M, et al. “The anti-cancer peptide, PNC-27, induces tumor cell necrosis of a poorly differentiated non-solid tissue human leukemia cell line that depends on expression of HDM-2 in the plasma membrane of these cells.” Ann Clin Lab Sci. 2014;44(3):241–248. PMID 25117093. pubmed.ncbi.nlm.nih.gov/25117093.
- Wang H, Zhao D, Nguyen LX, et al. “Targeting cell membrane HDM2: A novel therapeutic approach for acute myeloid leukemia.” Leukemia. 2020;34(1):75–86. PMID 31337857. pubmed.ncbi.nlm.nih.gov/31337857. The one substantial study from an unaffiliated group; PNC-27 supplied by Oncolyze Inc as disclosed.
- Sarafraz-Yazdi E, Mumin S, Cheung D, et al. “PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis.” Biomedicines. 2022;10(5):945. PMID 35625682. pubmed.ncbi.nlm.nih.gov/35625682. Source of the full sequence and the patent-inventor disclosure.
- National Center for Biotechnology Information. “PubChem Compound Summary for CID 16201774, PNC-27.” pubchem.ncbi.nlm.nih.gov/compound/16201774 (formula, mass, CAS 1159861-00-3).
To see the whole range rather than this one compound, open the research peptides catalogue.
RESEARCH USE ONLY — NOT FOR HUMAN CONSUMPTION. All products are sold strictly for in-vitro laboratory research and are not intended for human or veterinary use, ingestion, or administration. Nothing on this page is a medical or efficacy claim. You must be 21 or older to browse this catalog.