BPC-157 + TB-500 Blend Research: What the Literature Actually Covers
The BPC-157 + TB-500 pairing is the most frequently searched two-peptide preparation in the catalogue, and the honest reference page for it is not a summary of what the blend does — it is an account of what has and has not been studied. Both peptides have substantial independent literatures. The pairing has none: a documented search of PubMed, Europe PMC and ClinicalTrials.gov in July 2026 returned no study in which the two were administered together. This page gives per-component reference data, summarises each literature, records that search, and explains why a two-component vial is harder to verify analytically than a single peptide. Laboratory research material only.
What is the BPC-157 + TB-500 blend?
It is a research preparation that supplies two chemically unrelated synthetic peptides in a single vial. The first, BPC-157, is a 15-residue peptide corresponding to a fragment of a protein identified in gastric juice. The second, TB-500, is a research-catalogue name for material based on thymosin β4, a naturally occurring 43-residue peptide. They share no sequence, no receptor family and no discovery lineage. What they share is a catalogue shelf.
Supplier listings for this pairing are quoted per component at equal milligram amounts: 5 mg + 5 mg, 10 mg + 10 mg, and 15 mg + 15 mg, giving vial totals of 10 mg, 20 mg and 30 mg. The 1:1 milligram ratio is worth reading carefully, because it is a mass ratio, not a molar one — the two peptides differ in molecular weight by roughly 3.5-fold, so equal milligrams means substantially unequal molar quantities. That is an arithmetic consequence of how the material is packaged, and it is stated here because it affects how the vial should be characterised analytically, not because it implies anything about what the contents do.
The catalogue also lists a named product built on this pairing. Wolverine is one specific 20 mg preparation (10 mg TB-500 + 10 mg BPC-157); that page identifies the product and its composition. Two further multi-peptide preparations in the catalogue contain both of these peptides alongside others — GLOW (adding GHK-Cu) and KLOW (adding GHK-Cu and KPV). Each is a separate composition; none of them is evidence for any of the others.
Reference data — per component
A blend has no single set of molecular properties, so the table is given per component. Values are drawn from the public chemical record and, for thymosin β4, from the reviewed protein record. Fields that could not be sourced are omitted rather than estimated.
BPC-157
| Property | Value |
|---|---|
| Peptide class | Pentadecapeptide (15 residues), single chain |
| One-letter sequence | GEPPPGKPADDAGLV |
| Molecular formula | C₆₂H₉₈N₁₆O₂₂ |
| Molecular weight | ≈ 1419.5 Da (average) |
| CAS number | 137525-51-0 |
| PubChem CID | 9941957 |
| Physical form | Lyophilized powder |
TB-500 / thymosin β4
| Property | Value |
|---|---|
| Peptide class | β-thymosin family; intrinsically disordered in isolation |
| Mature sequence (43 residues) | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Reference record | UniProtKB P62328 — 44-residue precursor, mature chain residues 2–44 |
| Molecular weight | ≈ 4963 Da for the N-terminally acetylated 43-residue form |
| Physical form | Lyophilized powder |
| Naming caveat | “TB-500” is a catalogue label; some material corresponds to full-length thymosin β4 and some to a fragment of it |
That last row is not pedantry, and it is the single most important line in this section. Because “TB-500” is a trade label rather than a defined chemical entity, two vials bearing the same name can contain materially different molecules — the full 43-residue peptide in one, a short actin-binding fragment in another. A molecular weight is therefore only meaningful once the specific material is identified, which is what a per-batch certificate is for. The TB-500 research page covers this naming problem in full.
What each component's own literature has examined
The two evidence bases are entirely separate and are summarised here only briefly; each links to its full page. Every line below describes what researchers studied in model systems, not an effect in any reader.
BPC-157
The defining feature of the BPC-157 literature is that it does not converge on a single receptor. Studies describe the peptide as pleiotropic and have examined VEGFR2-associated angiogenesis, the nitric-oxide system, ERK1/2 signalling and cytokine modulation across cell and animal models. The corresponding weakness is equally defining: the record is overwhelmingly preclinical, and much of it originates from a small number of research groups. Recent reviews of the peptide market place it explicitly in the “unapproved” category (Mendias & Awan, Sports Med 2026; Mayfield et al., Am J Sports Med 2026). Full detail, including the individual studies and the registered clinical work, is on the BPC-157 research page.
TB-500 / thymosin β4
The best-characterised biochemistry here is far more specific. Thymosin β4 is described as the principal G-actin–sequestering peptide in mammalian cells: it binds monomeric actin and buffers the free-monomer pool, an interaction whose sensitivity to the ATP/ADP ratio was characterised by Carlier et al. (1993) and whose structural basis was resolved by Irobi et al. (2004). Beyond actin sequestration the literature broadens considerably and becomes, again, predominantly preclinical. Full detail is on the TB-500 research page.
Notice what these two summaries do not do: they do not describe a shared pathway, a common target or a mechanistic point of contact. One literature is about a promiscuous small peptide with no agreed receptor; the other is about a specific protein–protein interaction with a solved structure. Nothing in either body of work predicts what the two would do in combination, which is precisely why the next section is the important one.
Is there any published study of the combination? A documented check
Because this is the question the page exists to answer, the check is reported rather than asserted. In July 2026 the following searches were run:
- PubMed — BPC-157 combined with TB-500 or thymosin beta 4. Six records. All are narrative or systematic reviews of the wider peptide market, plus one case series concerning BPC-157 alone. None reports an experiment in which the two were administered together.
- Europe PMC — title-and-abstract search for both terms, which additionally covers preprints. Six records, the same profile: reviews and one clinical case report.
- ClinicalTrials.gov — BPC-157 AND TB-500. Zero registered studies.
The result is unambiguous: no published study of the BPC-157 and TB-500 combination could be identified — no controlled experiment, no animal model, no registered trial, no preprint. The records that mention both compounds do so because they survey a market in which both are sold, not because anyone studied them together.
The consequence follows directly. Putting these two peptides in one vial is a supplier packaging decision, not a research finding. This page makes no claim that the two act together, no claim that a combination is preferable to either component, and offers no comparison between the blend and either peptide on its own — because there is no measurement from which such a comparison could honestly be drawn.
It is worth being explicit about why an absence of this kind is expected rather than surprising. Peer-reviewed pharmacology is built around single, defined molecules studied in isolation, so that an observed effect can be attributed to one compound; a two-peptide vial is assembled at the catalogue stage, where no attribution problem needs solving. A study of the pair would be a distinct piece of work requiring its own controls — minimally, arms for each peptide alone as well as the combination — and that work has not been done. Anyone who encounters a confident claim about what this pairing achieves is reading something that no published measurement supports.
Evidence status and what is not established
What is established, and only this: each component exists as a defined synthetic material with a public chemical or protein record; each has its own body of largely preclinical literature, summarised above and detailed on its own page; and thymosin β4’s actin-sequestering interaction has been characterised biochemically and structurally.
What is not established, and is deliberately not claimed anywhere on this page: (1) anything at all about the two peptides administered together, for the reasons documented above; (2) any additive, complementary or reinforcing relationship between their mechanisms — no shared pathway has been demonstrated and none is asserted here; (3) any human clinical characterisation of either compound sufficient to describe outcomes, since the human record for both remains thin; and (4) any property of research-grade supplied material derived from the published work, which used characterised laboratory reagents under experimental conditions.
Neither BPC-157 nor TB-500 is an approved medicine in any jurisdiction, and no combination of them has been submitted to, or reviewed by, any regulator. Material described here is a laboratory research reagent: not a medicine, not for human or veterinary use, and no dosing, preparation-for-use or administration guidance appears on this page.
How to verify this compound yourself
Verification is where a two-component preparation genuinely differs from a single peptide, and the difference is practical rather than philosophical. Four points matter:
- A single purity percentage is ambiguous. For one peptide, “98.5% by HPLC” means the target accounts for 98.5% of the integrated chromatogram. For a two-peptide vial, the same number could describe the combined area of both peaks, the larger peak alone, or a method that never resolved them — three different claims. A useful certificate states which, and reports each component separately.
- Identity must confirm two masses, not one. Mass spectrometry should return both expected masses — roughly 1419.5 Da and, for the full-length thymosin β4 form, roughly 4963 Da. Confirming one and inferring the other is not confirmation. The 3.5-fold size difference also means a chromatographic gradient optimised for the small peptide is not automatically appropriate for the large one.
- Content is a separate question from purity. Purity describes the proportion of a sample that is the target; it says nothing about how much of each peptide the vial contains. For a blend quoted as two separate milligram figures, per-component quantitation is the number that corresponds to the label.
- Endotoxin and sterility, where tested, are independent quality attributes reported separately from any chemical purity figure.
That these checks are not routine is documented rather than assumed. A 2026 preprint by Mendias and Awan analysed 6,441 samples across fourteen compounds — BPC-157 and TB-500 among them — using a large public independent-testing dataset, and reported that between 41.6% and 71.1% of samples failed basic quality criteria depending on which of two acceptance frameworks was applied, with measurable endotoxin in 15%. The authors note that consumer-directed third-party testing improves transparency but captures only a fraction of the relevant safety profile. It is a preprint and has not completed peer review; it is cited here because it is the largest published look at exactly this material class, and because it is unflattering to the market this catalogue sits in.
For method-level detail see how to read a COA, how to verify peptide purity and how to spot a fake COA. Check the exact batch on the self-serve verify tool.
Research-grade sourcing and verification
The generic two-component preparation appears in the sourcing catalogue as available to order at 10 mg, 20 mg and 30 mg vial totals: our supplier lists it, we do not hold it in stock, and sourcing takes roughly two to three weeks with no price quoted until availability is confirmed. The catalogue also carries this pairing under the product name Wolverine at 20 mg total; current availability for either listing is whatever the catalogue shows, not what this page says.
Anything supplied is a laboratory research reagent accompanied by a per-batch Certificate of Analysis. For a blend, identity confirmation of each sequence is the whole of the assurance, and the section above sets out what a certificate has to report for that assurance to mean anything.
Verify a batch
Every order ships with a per-batch Certificate of Analysis. Have a vial in hand? Enter its lot number to look up the COA for that exact batch.
Frequently asked questions
What is the BPC-157 + TB-500 blend?
Has anyone published a study of BPC-157 and TB-500 given together?
So is the combination better than either peptide alone?
How does this page differ from the Wolverine blend page?
Why is a two-component vial harder to verify than a single peptide?
Literature cited
- Carlier MF, Jean C, Rieger KJ, Lenfant M, Pantaloni D. “Modulation of the interaction between G-actin and thymosin β4 by the ATP/ADP ratio: possible implication in the regulation of actin dynamics.” Proc Natl Acad Sci U S A. 1993;90(11):5034–5038. PMID 8506348. pubmed.ncbi.nlm.nih.gov/8506348. (TB-500 component.)
- Irobi E, Aguda AH, Larsson M, et al. “Structural basis of actin sequestration by thymosin-β4: implications for WH2 proteins.” EMBO J. 2004;23(18):3599–3608. PMID 15329672. pubmed.ncbi.nlm.nih.gov/15329672. (TB-500 component.)
- Mendias CL, Awan TM. “Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance.” Sports Med. 2026. PMID 41966639. pubmed.ncbi.nlm.nih.gov/41966639. (Review covering both compounds separately.)
- Mayfield CK, Bolia IK, Petrigliano FA, et al. “Injectable Peptide Therapy: A Primer for Orthopaedic and Sports Medicine Physicians.” Am J Sports Med. 2026;54(1):223–229. PMID 41476424. pubmed.ncbi.nlm.nih.gov/41476424.
- Mendias CL, Awan TM. “Evaluation of Research Grade Peptides Marketed Directly to Consumers Reveals Extensive Variability in Purity and Measured Abundance.” Preprints (not peer reviewed). 2026. doi.org/10.20944/preprints202604.1748.v1. (6,441 samples; 41.6–71.1% failed basic quality criteria; endotoxin in 15%.)
- Lee E, Padgett B. “Intra-Articular Injection of BPC 157 for Multiple Types of Knee Pain.” Altern Ther Health Med. 2021;27(4):8–13. PMID 34324435. pubmed.ncbi.nlm.nih.gov/34324435. (BPC-157 alone; the only non-review record returned by the combination search.)
- UniProt Consortium. “UniProtKB P62328 (TYB4_HUMAN) — Thymosin beta-4.” uniprot.org/uniprotkb/P62328 (44-residue precursor; mature chain 2–44).
- National Center for Biotechnology Information. “PubChem Compound Summary for CID 9941957, BPC-157.” pubchem.ncbi.nlm.nih.gov/compound/9941957 (formula, mass).
All the research peptides Cellworks can source are catalogued on one page, whether or not they are currently in stock.
RESEARCH USE ONLY — NOT FOR HUMAN CONSUMPTION. All products are sold strictly for in-vitro laboratory research and are not intended for human or veterinary use, ingestion, or administration. Nothing on this page is a medical or efficacy claim. You must be 21 or older to browse this catalog.